Skip to content

Latest commit

 

History

26 Commits

Folders and files

NameName
Last commit message
Last commit date
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

TCR-TRANSLATE: Conditional Generation of Real Antigen Specific T-cell Receptor Sequences

DOI DOI:10.1038/s42256-025-01096-6

In this work, we present a novel framework for addressing the task of antigen-specific TCR design in the face of a well known data sparsity issue that has hindered numerous efforts at modeling TCR:pMHC specificity. We apply techniques from low-resourced machine translation to standard sequence-to-sequence modeling, including data augmentation, joint pre-training, and bidirectional training, to boost the sampling of experimentally validated antigen-specific TCRs. By constructing a target-rich validation set on well studied epitopes, we release TCRT5, a T5-based model that performed well on accuracy and diversity metrics. The model demonstrated remarkable generalization capability, successfully generating valid CDR3b sequences for epitopes outside its training distribution. While the current implementation establishes the capacity of seq2seq models to recapitulate accurate TCR sequence information by focusing on the functionally diverse CDR3b sequences, we hope to apply this framework for computational whole receptor TCR design that can significantly accelerate therapeutic development pipelines.

How to use

This repository contains the raw data, results, and code for training and evaluating our flagship TCRT5 (finetuned) model. Typcial installation can be done using pip. Installation should take only a few minutes. If you would like to use our model directly, we make our model available on HuggingFace's model hub. You can find the models here:

Additional models will be released as they are evaluated and deemed useful. Please check this HuggingFace collection for the latest.

Model Usage

You can use this model directly for conditional CDR3b generation in a few seconds (scales with the number of beams searched):

import re
from transformers import T5Tokenizer, T5ForConditionalGeneration
tokenizer = T5Tokenizer.from_pretrained('dkarthikeyan1/tcrt5_ft_tcrdb')
tcrt5 = T5ForConditionalGeneration.from_pretrained("dkarthikeyan1/tcrt5_ft_tcrdb")
pmhc = "[PMHC]KLGGALQAK[SEP]YFAMYQENVAQTDVDTLYIIYRDYTWAELAYTWY[EOS]"
encoded_pmhc = tokenizer(pmhc, return_tensors='pt')

# Define the number of TCRs you would like to generate ()
num_tcrs = 10
# Define the number of beams to explore (recommended: 3x the number of TCRs)
num_beams = 30

outputs = tcrt5.generate(**encoded_pmhc, max_new_tokens=25, num_return_sequences=num_tcrs, num_beams=num_beams, return_dict_in_generate=True)

# Use regex to get out the [TCR] tag
cdr3b_sequences = [re.sub(r'\[.*\]', '', x) for x in tokenizer.batch_decode(outputs['sequences'], skip_special_tokens=True)]

>>> cdr3b_sequences

['CASSLGTGGTDTQYF',
 'CASSPGTGGTDTQYF',
 'CASSLGQGGTEAFF',
 'CASSVGTGGTDTQYF',
 'CASSLGTGGSYEQYF',
 'CASSPGQGGTEAFF',
 'CASSSGTGGTDTQYF',
 'CASSLGGGGTDTQYF',
 'CASSLGGGSYEQYF',
 'CASSLGTGGNQPQHF']

This model can also be used for unconditional generation of CDR3b sequences:

import re
from transformers import T5Tokenizer, T5ForConditionalGeneration
tokenizer = T5Tokenizer.from_pretrained('dkarthikeyan1/tcrt5_ft_tcrdb')
tcrt5 = T5ForConditionalGeneration.from_pretrained("dkarthikeyan1/tcrt5_ft_tcrdb")


# Define the number of TCRs you would like to generate ()
num_tcrs = 10
# Define the number of beams to explore (recommended: 3x the number of TCRs)
num_beams = 30

unconditional_outputs = tcrt5.generate(max_new_tokens=25, num_return_sequences=num_tcrs, num_beams=num_beams, return_dict_in_generate=True)

# Use regex to get out the [TCR] tag
uncond_cdr3b_sequences = [re.sub(r'\[.*\]', '', x) for x in tokenizer.batch_decode(unconditional_outputs['sequences'], skip_special_tokens=True)]

>>> uncond_cdr3b_sequences

['CASSLGGETQYF',
 'CASSLGQGNTEAFF',
 'CASSLGQGNTGELFF',
 'CASSLGTSGTDTQYF',
 'CASSLGLAGSYNEQFF',
 'CASSLGLAGTDTQYF',
 'CASSLGQGYEQYF',
 'CASSLGLAGGNTGELFF',
 'CASSLGGTGELFF',
 'CASSLGQGAYEQYF']

If you would like to see a more detailed demo of our model, please check out our Colab notebook Coming Soon.

Contributing

We are currently in the process of exploring many things branching off of TCR-TRANSLATE. If you would like to contribute, please reach out to us at dkarthikeyan1@unc.edu with a brief description of your background and how you would like to contribute. Alternatively, if you have any feature requests or bug reports, please open an issue on this repository. Thank you!

Contact

For more information please reach out to us at: {dkarthikeyan1, alex.rubinsteyn}@unc.edu

Citation

@Article{Karthikeyan2025_tcrtranslate,
author={Karthikeyan, Dhuvarakesh
and Bennett, Sarah N.
and Reynolds, Amy G.
and Vincent, Benjamin G.
and Rubinsteyn, Alex},
title={Conditional generation of real antigen-specific T cell receptor sequences},
journal={Nature Machine Intelligence},
year={2025},
month={Sep},
day={08},
abstract={Despite recent advances in T cell receptor (TCR) engineering, designing functional TCRs against arbitrary targets remains challenging due to complex rules governing cross-reactivity and limited paired data. Here we present TCR-TRANSLATE, a sequence-to-sequence framework that adapts low-resource machine translation techniques to generate antigen-specific TCR sequences against unseen epitopes. By evaluating 12 model variants of the BART and T5 model architectures, we identified key factors affecting performance and utility, revealing discordances between these objectives. Our flagship model, TCRT5, outperforms existing approaches on computational benchmarks, prioritizing functionally relevant sequences at higher ranks. Most significantly, we experimentally validated a computationally designed TCR against Wilms' tumour antigen, a therapeutically relevant target in leukaemia, excluded from our training and validation sets. Although the identified TCR shows cross-reactivity with pathogen-derived peptides, highlighting limitations in specificity, our work represents the successful computational design of a functional TCR construct against a non-viral epitope from the target sequence alone. Our findings establish a foundation for computational TCR design and reveal current limitations in data availability and methodology, providing a framework for accelerating personalized immunotherapy by reducing the search space for novel targets.},
issn={2522-5839},
doi={10.1038/s42256-025-01096-6},
url={https://doi.org/10.1038/s42256-025-01096-6}
}

About

Accompanying Repository to TCR-TRANSLATE paper.

Topics

Resources

Stars

12 stars

Watchers

1 watching

Forks

Releases

Packages

Used by

Contributors

Languages